PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001870G0190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family bZIP
Protein Properties Length: 241aa    MW: 26369.8 Da    PI: 10.5336
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001870G0190genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.81.7e-1142100563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l++l+     l+se+
  PH01001870G0190  42 KRAKRILANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLSMLQRDTTGLTSEN 100
                      9************************************************9999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.9E-1838102IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.13940103IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.6E-124297No hitNo description
PfamPF001706.8E-1042100IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.45E-114297No hitNo description
CDDcd147031.16E-204392No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MSMDGSTSLA SAATGVAGRA AADAKKAISD AKLAELALVD PKRAKRILAN RQSAARSKER  60
KMRYIAELER KVQTLQTEAT TLSAQLSMLQ RDTTGLTSEN SDLKLRVQTM EQQVRLQDAL  120
NDRLRDEIQK LKIATGQVNA NSGKMGNFGP SSYGVNSRSY QRSHIQSLLA AQQLQQLQIH  180
SQHQQQQMHL QQQYLSSAQQ QQLLQEALPL PVDLKMKGIA TTSHAQNAGV SDSHALRSEP  240
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3668881e-149AK366888.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2047M20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633411.11e-122PREDICTED: transcription factor RF2a-like
SwissprotQ040884e-67POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A0D3FXG21e-125A0A0D3FXG2_9ORYZ; Uncharacterized protein
STRINGLOC_Os04g41820.11e-122(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123022937
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.13e-57bZIP family protein